Skip to main content
KimeraCHEMS
Display
  • C
  • N
  • O

Calculated reference model · not an experimental or batch-certified structure. Backbone view: 185 of 378 atoms.

Model data & sources
  • All-D peptide-core reference; acetate/TFA counterion stoichiometry is not assigned.
  • Heavy atoms only; hydrogens are omitted from the reference display.
  • Source-defined atom stereochemistry is checked against the calculated coordinates; no energy-minimum or observed-fold claim is made.
  • Reference molecular species only; batch counterions, excipients and material composition are not certified.
  • Force-field relaxation reached its iteration limit. This is a geometry-checked reference, not a proven equilibrated or minimum-energy structure.
Sequence
LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
Formula
C228H388N86O64
Method
Source-identical PeptideBuilder idealized backbone / MMFF94s calculated reference conformer
In stock nowBrowse more certificates
Batch
KC-FX4-GRY1
Made
2026-08-31
Reports
1 on file
Everything shipping from this page today came off this batch. The code is printed on your label, and one certificate covers the whole batch.

FOXO4-DRI

Peptides

Published formats

  • Standard Reference Vial

Supplementary product details from the published catalog, checked 2026-10-07. These reference details do not establish current availability.

Pricing

Pricing and order placement are reserved for reviewed research accounts. Log in or submit an account application to view current product pricing.

Log in to view priceApply for account

Technical Specifications

Batch COA Database ↗
CAS Registry Number2460055-10-9
Molecular FormulaC228H388N86O64
Molecular Weight5358.05
IUPAC Designation(4R)-5-[[(2R)-1-[[(2R)-1-[[(2R)-1-[[(2R)-5-amino-1-[[(2R)-4-amino-1-[[2-[[(2R)-1-[[(2R)-1-[[(2R)-4-amino-1-[[(2R)-1-[[(2R)-1-[[(2R)-1-[[2-[[2-[[(2R)-6-amino-1-[[(2R)-1-[(2R)-2-[(2R)-2-[(2R)-2-[[(2R)-1-[[(2R)-1-[[(2R)-1-[[(2R)-5-amino-1-[[(2R)-1-[[(2R)-1-[[(2R)-6-amino-1-[[(2R)-6-amino-1-[[(2R)-5-carbamimidamido-1-(carboxymethylamino)-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxohexan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]carbamoyl]pyrrolidine-1-carbonyl]pyrrolidine-1-carbonyl]pyrrolidin-1-yl]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-2-oxoethyl]amino]-2-oxoethyl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-1,4-dioxobutan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-[[(2R)-2-[[(2R,3R)-2-[[(2R)-2-[[(2R)-5-amino-2-[[(2R)-2-[[(2R,3R)-2-[[(2R)-2-[[(2R)-2-[[(2R)-2-[[(2R)-1-[(2R)-2-[[(2R)-6-amino-2-[[(2R)-2-[[(2R)-2-[[(2R,3S)-2-[[(2R)-2-amino-4-methylpentanoyl]amino]-3-hydroxybutanoyl]amino]-4-methylpentanoyl]amino]-5-carbamimidamidopentanoyl]amino]hexanoyl]amino]-4-carboxybutanoyl]pyrrolidine-2-carbonyl]amino]propanoyl]amino]-3-hydroxypropanoyl]amino]-4-carboxybutanoyl]amino]-3-methylpentanoyl]amino]propanoyl]amino]-5-oxopentanoyl]amino]-3-hydroxypropanoyl]amino]-3-methylpentanoyl]amino]-4-methylpentanoyl]amino]-5-oxopentanoic acid
Physical FormRefer to product documentation
Storage RequirementsRefer to product documentation
Other NamesProxofim

Identity fields from the published product record, checked 2026-10-07. Reference information is not a batch identity certificate.

Research Overview

FOXO4-DRI Research Standard

FOXO4-DRI (CAS 2460055-10-9), also indexed as proxofim, is supplied as a 10 mg lyophilized powder in a 3 mL vial. The DRI in its name is D-retro-inverso: the sequence is reversed and built from D-amino acids, a standard strategy for producing a peptide that presents a similar side-chain topology to the L-peptide while resisting proteolysis.

Mechanism of Action & Research Context

Its target is a protein-protein interaction rather than a receptor, which puts it in a different design category from most peptides sold for research.

  • It blocks the FOXO4-p53 interaction. FOXO4 is a forkhead box O transcription factor. In senescent cells it maintains viability and suppresses apoptosis. FOXO4-DRI, described as a specific FOXO4 blocker, disrupts the FOXO4-p53 interaction, which selectively induces p53 nuclear exclusion and apoptosis in senescent cells.[1]

  • Selectivity comes from the biology, not the molecule. The peptide is not cell-type selective by design — it works where the FOXO4-p53 interaction is doing the work of keeping a senescent cell alive. That is the whole senolytic premise, and it means a model without a genuine senescent population has nothing to demonstrate.[1]

  • Characterised in a defined senescence model. Hydrogen peroxide-induced senescent TM3 Leydig cells were used as the in vitro system, with FOXO4 nuclear translocation in aged human tissue as the observation motivating it. In naturally aged mice, FOXO4-DRI improved the testicular microenvironment.[1]

  • Nuclear localisation is the readout. The mechanism is expressed as p53 moving out of the nucleus, so imaging or fractionation beats a simple viability assay for demonstrating it.[1]

Research Applications

Primary fields of in vitro and preclinical laboratory investigation include:

  • Senescent cell models, such as H2O2-induced senescence, with non-senescent controls.[1]

  • FOXO4-p53 interaction assays by co-immunoprecipitation or proximity methods.[1]

  • p53 subcellular localisation by imaging or nuclear/cytoplasmic fractionation.[1]

  • Senescence marker panels paired with apoptosis readouts.[1]

  • Proteolytic stability comparison against the L-peptide equivalent.

Analytical Documentation

Purity and identity vary by manufacturing lot. Kimera Chems does not publish a single fixed purity figure for this item; refer to the batch-specific Certificate of Analysis (COA) issued for the lot received, which reflects third-party analytical testing for that lot.

References

  1. Zhang C, Xie Y, Chen H, et al. FOXO4-DRI alleviates age-related testosterone secretion insufficiency by targeting senescent Leydig cells in aged mice. Aging (Albany NY). 2020;12(2):1272–1284. doi:10.18632/aging.102682

Storage & Handling

Store at controlled room temperature, sealed and protected from light.

Storage guidance is a house recommendation. Analytical documentation is per-lot release testing.

Related Research Compounds

Research Use Only Disclaimer: This product is labeled and sold "For Research Use Only - NOT FOR HUMAN CONSUMPTION." It is not a drug, dietary supplement, food, cosmetic, or medical device, and it is not approved by the FDA or any other regulator for human or veterinary use. It is supplied to approved account holders as a research chemical for laboratory use and must be handled in accordance with applicable law.

Currently shipping from batch KC-FX4-GRY1.

Related products

Kimera Chems

Compounds That Survive Scrutiny

Research use only. Not for human or veterinary use.